Cagri-Sema 2.4/2.4mg

Chemical Information:

Cagrilintide:

• Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
• Molecular Weight: 3946.32 g/mol
• Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)

Semaglutide:

• Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉

• Molecular Weight: 4113.58 g/mol

• Sequence: HA¹EGTFTSDVSSYLEGQAAKEFIAWLVKGRG (Modified with an octanoic acid side chain at lysine position)

• Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Description:
The Cagrilintide & Semaglutide Blend combines two extensively researched peptides—Cagrilintide, a long-acting amylin analog, and Semaglutide, a GLP-1 analog—each known for their complementary roles in metabolic regulation. This innovative combination is specifically formulated for advanced research into appetite modulation, weight management, glucose metabolism, and metabolic homeostasis. Supplied as a lyophilized powder, this blend supports studies investigating synergistic metabolic and endocrine pathways.

Research Applications:
Cagrilintide & Semaglutide Blend is actively studied for potential roles in:

• Appetite and Satiety Regulation: Investigating combined peptide effects on appetite suppression, satiety signaling, and energy intake modulation.
• Weight Management Studies: Evaluating synergistic mechanisms contributing to sustainable reductions in body weight and adiposity.
• Metabolic Pathways: Examining dual peptide actions on glucose metabolism, insulin sensitivity, lipid regulation, and metabolic efficiency.
• Gastrointestinal and Neuroendocrine Interactions: Exploring peptide interactions influencing nutrient absorption, gastric motility, and neuroendocrine signaling pathways involved in hunger and satiety.

Storage and Handling:

• Store lyophilized powder at -20°C.
• After reconstitution, refrigerate at 2-8°C and use promptly.
• Maintain aseptic handling practices to ensure sterility and product integrity.

Product Specifications:

• Purity: ≥99% (HPLC Verified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in bacteriostatic water

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide blend is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

References:
Referenced scientific publications include:

• Lau, D. C., et al. (2021). “Cagrilintide, a Long-Acting Amylin Analogue, for Weight Management in Adults with Overweight and Obesity: A Randomised, Controlled, Phase 2 Trial.” The Lancet.
• Wilding, J. P. H., et al. (2021). “Semaglutide for Weight Management in Adults with Obesity.” Lancet Diabetes & Endocrinology.
• Enebo, L. B., et al. (2021). “Safety, Tolerability, and Efficacy of Cagrilintide for Weight Management: Findings from a Phase 1 Clinical Study.” Diabetes, Obesity and Metabolism.
• Marso, S. P., et al. (2016). “Semaglutide and Cardiovascular Outcomes in Type 2 Diabetes.” New England Journal of Medicine.