Same-Day Delivery in Las Vegas · FedEx 2Day Nationwide Veteran Owned | USA Made | ISO Certified Facility Third-Party Tested | GMP Compliant
TH9507 - Tesa 10mg
≥99% HPLC verified

TH9507 – Tesa 10mg

$74.00

In stock Purchase & earn 74 points!
Buy 5+ save 5% · 10+ save 15%
Need 100+? Wholesale inquiry
Certificates of Analysis
LOT
112455
Purity99.9%
Net Content10.53 mg
Tested06/15/26
View COA
LOT
253110
Purity99.89%
Net Content9.45 mg
Tested11/19/25
View COA
  • Third-party tested
  • Sealed & lyophilized
  • Synthesized in USA
  • Same-day shipping*

*Orders before 12 PM PST, Mon–Fri. Discreet packaging on every order.

View the full TH9507 – Tesa Certificate of Analysis & lab reports →

Molecular Structure

The TH9507 - Tesa molecule

Know exactly what you’re getting. Explore the verified molecular structure and lab-confirmed specifications of TH9507 - Tesa — third-party tested for identity and purity, and synthesized in the USA.

Drag to rotate

Molecular Formula

C221H366N72O67S

Molecular Weight

5136 g/mol

CAS / ID

218949-48-5

Physical Form

Lyophilized Powder

Documented Purity

99%+

Use Class

Research use only

Structure & molecular data from PubChem CID 16137828; the 3D conformation is an illustrative model. For research use only — not for human or veterinary use.

Description

Chemical Information of TH9507 – Tesa 10mg

  • Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
  • CAS Number: 218949-48-5
  • Molecular Weight: 5195.9 g/mol
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling of TH9507 – Tesa 10mg

  • Store sealed at recommended laboratory freezer temperatures.

  • Protect from light, moisture, and excessive heat.

  • Handle using standard laboratory safety procedures to maintain product integrity.

TH9507 – Tesa 10mg Product Specifications

  • Purity: ≥99% (HPLC Verified)

  • Appearance: White to off-white lyophilized powder

  • Solubility: Refer to Certificate of Analysis for physicochemical properties

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

Frequently asked questions

Research use only. Not for human or veterinary use.

What is TH9507?

TH9507 is a synthetic 44 residue peptide carrying an N-terminal trans-3-hexenoyl modification, which distinguishes it from the unmodified 44 residue growth hormone releasing hormone sequence. Its molecular formula is C221H366N72O67S, molecular weight 5136 g/mol CAS number 218949-48-5 and PubChem CID 16137828. It is one of the largest peptides in the Oasis Labs catalogue. It is supplied as a lyophilized powder for laboratory research use only, at 99%+ documented purity, with lot-specific figures recorded on the published Certificate of Analysis.

How does TH9507 differ from Sermorelin and CJC-1295?

Length, and the pattern of modification each carries. TH9507 is 44 residues at 5136 g/mol and carries an N-terminal acyl modification. Sermorelin is 29 residues at 3357.9 g/mol, corresponding to the first 29 residues of GHRH with no further modification. CJC-1295 is a 29-residue analogue carrying substitutions within the chain, listed in two forms, one with a drug affinity complex (DAC) at 3647.2 g/mol and one without it at 3367.9 g/mol. Published preclinical work on each is specific to that compound and to the assay system it was run in, so findings on one are not transferable to another. All are supplied strictly as research reagents. No human or veterinary use is described, supported or intended.

What has TH9507 been studied for in research settings?

Published preclinical literature has examined TH9507 as an analogue of growth hormone releasing hormone acting at the GHRH receptor, and reported findings in in vitro and animal models concern receptor binding and downstream signalling in those experimental systems. Oasis Labs supplies this material strictly as a research reagent. No human or veterinary use is described, supported or intended.

What are the specifications for Oasis Labs TH9507 10mg?

SKU TH9507-10MG. Supplied as a 10mg vial of lyophilized powder, white to off-white in appearance. Molecular formula C221H366N72O67S, molecular weight 5136 g/mol, CAS 218949-48-5, 44 amino acid residues. Identity, purity and net content are documented per lot on the published Certificate of Analysis.

Where can researchers buy TH9507 with third-party testing?

Oasis Labs supplies TH9507 10mg direct to researchers from the USA, with fulfilment handled in Las Vegas, Nevada. Current pricing and bulk options are shown on the product page. Every lot is third-party tested and the Certificate of Analysis is published on the site and can be read in full before ordering. The TH9507 COA is available at myoasislabs.com/coa/th9507-tesa-10mg/ and the full testing methodology is documented at myoasislabs.com/coa-process/.

Is Oasis Labs TH9507 intended for human use?

No. This product is sold FOR RESEARCH USE ONLY and is not for human or veterinary use, including medical, therapeutic or diagnostic applications. It is intended exclusively for in vitro laboratory research conducted by qualified professionals. It is not a drug, food, cosmetic, dietary supplement or medical device, and nothing on this page describes or recommends administration to humans or animals.

Related products

TH9507 - Tesa 10mg $74.00