Same-Day Delivery in Las Vegas · FedEx 2Day Nationwide Veteran Owned | USA Made | ISO Certified Facility Third-Party Tested | GMP Compliant

TH9507 – Tesa 10mg

$74.00

In stock Purchase & earn 74 points!
Bulk pricing · save 15%
Buy 10, save $111.00.
$62.90 each was $74.00 · stacks with coupons
Certificates of Analysis
  • Third-party tested
  • Sealed & lyophilized
  • Synthesized in USA
  • Same-day shipping*

*Orders before 12 PM PST, Mon–Fri. Discreet packaging on every order.

Molecular Structure

The TH9507 - Tesa molecule

Know exactly what you’re getting. Explore the verified molecular structure and lab-confirmed specifications of TH9507 - Tesa — third-party tested for identity and purity, and synthesized in the USA.

Drag to rotate

Molecular Formula

C221H366N72O67S

Molecular Weight

5136 g/mol

CAS / ID

218949-48-5

Physical Form

Lyophilized Powder

Documented Purity

99%+

Use Class

Research use only

Structure & molecular data from PubChem CID 16137828; the 3D conformation is an illustrative model. For research use only — not for human or veterinary use.

Description

Chemical Information of TH9507 – Tesa 10mg

  • Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
  • CAS Number: 218949-48-5
  • Molecular Weight: 5195.9 g/mol
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling of TH9507 – Tesa 10mg

  • Store sealed at recommended laboratory freezer temperatures.

  • Protect from light, moisture, and excessive heat.

  • Handle using standard laboratory safety procedures to maintain product integrity.

TH9507 – Tesa 10mg Product Specifications

  • Purity: ≥99% (HPLC Verified)

  • Appearance: White to off-white lyophilized powder

  • Solubility: Refer to Certificate of Analysis for physicochemical properties


Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

TH9507 - Tesa 10mg $74.00