Same-Day Delivery in Las Vegas · FedEx 2Day Nationwide Veteran Owned | USA Made | ISO Certified Facility Third-Party Tested | GMP Compliant

Cagrilintide 5mg

$81.00

In stock Purchase & earn 81 points!
Bulk pricing · save 15%
Buy 10, save $121.50.
$68.85 each was $81.00 · stacks with coupons
Certificates of Analysis
  • Third-party tested
  • Sealed & lyophilized
  • Synthesized in USA
  • Same-day shipping*

*Orders before 12 PM PST, Mon–Fri. Discreet packaging on every order.

Molecular Structure

The Cagrilintide molecule

Know exactly what you’re getting. Explore the verified molecular structure and lab-confirmed specifications of Cagrilintide — third-party tested for identity and purity, and synthesized in the USA.

Drag to rotate

Molecular Formula

C194H312N54O59S2

Molecular Weight

4409 g/mol

CAS / ID

1415456-99-3

Physical Form

Lyophilized Powder

Documented Purity

99%+

Use Class

Research use only

Structure & molecular data from PubChem CID 171397054; the 3D conformation is an illustrative model. For research use only — not for human or veterinary use.

Description

Chemical Information of Cagrilintide 5mg

  • Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
  • CAS Number: 1415456-99-3
  • Molecular Weight: 3946.32 g/mol
  • Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)
  • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling of Cagrilintide 5mg

  • Store sealed at recommended laboratory freezer temperatures.

  • Protect from light, moisture, and excessive heat.

  • Handle using standard laboratory safety procedures to maintain product integrity.

Cagrilintide 5mg Product Specifications

  • Purity: ≥99% (HPLC Verified)

  • Appearance: White to off-white lyophilized powder

  • Solubility: Refer to Certificate of Analysis for physicochemical properties


Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.


 

Cagrilintide 5mg $81.00