≥99% HPLC verified

Cagrilintide 5mg

$81.00

In stock Purchase & earn 81 points!

Third-party tested
Sealed & lyophilized
Synthesized in USA
Same-day shipping*

*Orders before 12 PM PST, Mon–Fri. Discreet packaging on every order.

View the full Cagrilintide Certificate of Analysis & lab reports →

Molecular Structure

The Cagrilintide molecule

Know exactly what you’re getting. Explore the verified molecular structure and lab-confirmed specifications of Cagrilintide — third-party tested for identity and purity, and synthesized in the USA.

Drag to rotate

Molecular Formula

C₁₉₄H₃₁₂N₅₄O₅₉S₂

Molecular Weight

4409 g/mol

CAS / ID

1415456-99-3

Physical Form

Lyophilized Powder

Documented Purity

99%+

Use Class

Research use only

Structure & molecular data from PubChem CID 171397054; the 3D conformation is an illustrative model. For research use only — not for human or veterinary use.

Description

Description

Chemical Information of Cagrilintide 5mg

Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
CAS Number: 1415456-99-3
Molecular Weight: 3946.32 g/mol
Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)
Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling of Cagrilintide 5mg

Store sealed at recommended laboratory freezer temperatures.
Protect from light, moisture, and excessive heat.
Handle using standard laboratory safety procedures to maintain product integrity.

Cagrilintide 5mg Product Specifications

Purity: ≥99% (HPLC Verified)
Appearance: White to off-white lyophilized powder
Solubility: Refer to Certificate of Analysis for physicochemical properties

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

Frequently asked questions

Research use only. Not for human or veterinary use.

What is Cagrilintide?

Cagrilintide is a synthetic long-acting analogue of the peptide hormone amylin. Its molecular formula is C194H312N54O59S2, molecular weight 4409 g/mol and CAS number 1415456-99-3 (PubChem CID 171397054). It is a structurally modified amylin analogue supplied by Oasis Labs as a lyophilized powder at 99%+ documented purity for laboratory research use only.

How does Cagrilintide differ from native amylin?

Cagrilintide is a structurally modified analogue rather than the native hormone. The modifications reported in the literature alter its physicochemical stability and half-life profile relative to native amylin, which is why it is described as long-acting. Native human amylin and Cagrilintide are therefore separate chemical entities with different molecular formulas, molecular weights and CAS numbers. The Oasis Labs lot-specific Certificate of Analysis documents the identity and purity of the supplied material.

What has Cagrilintide been studied for in research settings?

Published preclinical literature has characterised Cagrilintide as an agonist at amylin and calcitonin receptors, and reported work in in vitro and animal models concerns receptor binding affinity and downstream signalling in those experimental systems. Oasis Labs supplies this material strictly as a research reagent for in vitro laboratory work. No human or veterinary use is described, supported or intended, and no therapeutic application is claimed.

What are the specifications for Oasis Labs Cagrilintide 5mg?

SKU CAG-5MG. Supplied as a 5mg vial of white to off-white lyophilized powder at 99%+ documented purity by HPLC. Molecular formula C194H312N54O59S2, molecular weight 4409 g/mol, CAS 1415456-99-3. Solubility and physicochemical data are given on the lot-specific Certificate of Analysis.

Where can researchers buy Cagrilintide with third-party testing?

Oasis Labs supplies Cagrilintide 5mg direct to researchers from the USA at $81.00 per vial. Every lot is third-party tested and the Certificate of Analysis is published openly rather than supplied only on request. The Cagrilintide COA is available at myoasislabs.com/coa/cagrilintide-5mg/ and the full testing methodology is documented at myoasislabs.com/coa-process/.

Is Oasis Labs Cagrilintide intended for human use?

No. This product is sold FOR RESEARCH USE ONLY and is not for human or veterinary use. It is intended exclusively for in vitro laboratory research conducted by qualified professionals. It is not a drug, food, cosmetic or medical device, and nothing on this page describes or recommends administration to humans or animals.