≥99% HPLC verified

LL-37 10mg

$65.00

In stock Purchase & earn 65 points!

Third-party tested
Sealed & lyophilized
Synthesized in USA
Same-day shipping*

*Orders before 12 PM PST, Mon–Fri. Discreet packaging on every order.

View the full LL-37 Certificate of Analysis & lab reports →

Molecular Structure

The LL-37 molecule

Know exactly what you’re getting. Explore the verified molecular structure and lab-confirmed specifications of LL-37 — third-party tested for identity and purity, and synthesized in the USA.

Drag to rotate

Molecular Formula

C₂₀₅H₃₄₀N₆₀O₅₃

Molecular Weight

4493 g/mol

CAS / ID

154947-66-7

Physical Form

Lyophilized Powder

Documented Purity

99%+

Use Class

Research use only

Structure & molecular data from PubChem CID 16198951; the 3D conformation is an illustrative model. For research use only — not for human or veterinary use.

Description

Description

Chemical Information:

Molecular Formula: C205H340N60O53
CAS Number: 154947-66-7
Molecular Weight: 4493.37 Da
Sequence: [LL-37, 37 aa] (37 amino acids)
Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling:

Store sealed at recommended laboratory freezer temperatures.
Protect from light, moisture, and excessive heat.
Handle using standard laboratory safety procedures to maintain product integrity.

Product Specifications:

Purity: ≥99% (HPLC Verified)
Appearance: White to off-white lyophilized powder
Solubility: Refer to Certificate of Analysis for physicochemical properties

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

Frequently asked questions

Research use only. Not for human or veterinary use.

What is LL-37?

LL-37 is a synthetic 37 residue peptide with the molecular formula C205H340N60O53, a molecular weight of 4493 g/mol and CAS number 154947-66-7 (PubChem CID 16198951). Its sequence is [LL-37, 37 aa], and its name comes from the two leucine residues that open the chain and its length. Oasis Labs supplies it as a lyophilized powder at 99%+ documented purity for laboratory research use only.

Is LL-37 the same as cathelicidin?

Not quite. LL-37 corresponds to the C-terminal fragment of the human cathelicidin precursor protein hCAP18, so it is a part of that molecule rather than the whole of it. The precursor is considerably larger; the fragment Oasis Labs supplies is 37 residues, C205H340N60O53 at 4493 g/mol, CAS 154947-66-7. Published literature often uses cathelicidin loosely to cover the LL-37 fragment as well as the precursor, which is why researchers comparing sources should check the CAS number rather than the name. Supplied strictly as a research reagent. No human or veterinary use is described, supported or intended.

What has LL-37 been studied for in research settings?

Published research on LL-37 includes work on its membrane interaction behaviour measured in laboratory assay systems. Oasis Labs supplies this material strictly as a research reagent. No human or veterinary use is described, supported or intended.

What are the specifications for Oasis Labs LL-37 10mg?

SKU LL37-10MG. Supplied as a 10mg vial of lyophilized powder, white to off-white in appearance, at 99%+ documented purity by HPLC. Molecular formula C205H340N60O53, molecular weight 4493 g/mol, CAS 154947-66-7, 37 amino acid residues. Identity, purity and net content are documented per lot on the published Certificate of Analysis.

Where can researchers buy LL-37 with a published Certificate of Analysis?

Oasis Labs supplies LL-37 direct to researchers from the USA, with fulfilment handled in Las Vegas, Nevada. Current pricing and bulk options are shown on the product page. Every lot is third-party tested and the Certificate of Analysis is published on the site and can be read in full before ordering. The LL-37 COA is available at myoasislabs.com/coa/ll-37-10mg/ and the full testing methodology is documented at myoasislabs.com/coa-process/.

Is Oasis Labs LL-37 intended for human use?

No. This product is sold FOR RESEARCH USE ONLY and is not for human or veterinary use, including medical, therapeutic or diagnostic applications. It is intended exclusively for in vitro laboratory research conducted by qualified professionals. It is not a drug, food, cosmetic, dietary supplement or medical device, and nothing on this page describes or recommends administration to humans or animals.

LL-37 10mg $65.00