Same-Day Delivery in Las Vegas · FedEx 2Day Nationwide Veteran Owned | USA Made | ISO Certified Facility Third-Party Tested | GMP Compliant

LL-37 10mg

$65.00

In stock Purchase & earn 65 points!
Bulk pricing · save 15%
Buy 10, save $97.50.
$55.25 each was $65.00 · stacks with coupons
Certificates of Analysis
  • Third-party tested
  • Sealed & lyophilized
  • Synthesized in USA
  • Same-day shipping*

*Orders before 12 PM PST, Mon–Fri. Discreet packaging on every order.

Molecular Structure

The LL-37 molecule

Know exactly what you’re getting. Explore the verified molecular structure and lab-confirmed specifications of LL-37 — third-party tested for identity and purity, and synthesized in the USA.

Drag to rotate

Molecular Formula

C205H340N60O53

Molecular Weight

4493 g/mol

CAS / ID

154947-66-7

Physical Form

Lyophilized Powder

Documented Purity

99%+

Use Class

Research use only

Structure & molecular data from PubChem CID 16198951; the 3D conformation is an illustrative model. For research use only — not for human or veterinary use.

Description

Chemical Information:

Molecular Formula: C205H340N60O53
CAS Number: 154947-66-7
Molecular Weight: 4493.37 Da
Sequence: [LL-37, 37 aa] (37 amino acids)
Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling:

Store sealed at recommended laboratory freezer temperatures.
Protect from light, moisture, and excessive heat.
Handle using standard laboratory safety procedures to maintain product integrity.

Product Specifications:

Purity: ≥99% (HPLC Verified)
Appearance: White to off-white lyophilized powder
Solubility: Refer to Certificate of Analysis for physicochemical properties

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

LL-37 10mg $65.00