• All Other
  • |
  • Cellular Regeneration
  • |
  • GHRH/GHRP

TH9507 – Tesa 10mg

Free Shipping on Orders Over $150!

  • Exceeds GMP Standards
  • Fast 2-day reliable shipping
  • Secure Payments

$84.00

In stock

Purchase & earn 84 points!
Bulk pricing · save 15%
Buy 10, save $126.00.
$71.40 each was $84.00 · stacks with coupons

Chemical Information:

  • Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
  • CAS Number: 218949-48-5
  • Molecular Weight: 5195.9 g/mol
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling:

  • Store sealed at recommended laboratory freezer temperatures.

  • Protect from light, moisture, and excessive heat.

  • Handle using standard laboratory safety procedures to maintain product integrity.

Product Specifications:

  • Purity: ≥99% (HPLC Verified)

  • Appearance: White to off-white lyophilized powder

  • Solubility: Refer to Certificate of Analysis for physicochemical properties


Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

LOT
253110Purity and ID
View COA

NOTICE:

This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.