Description
Oasis Labs Peptides is a veteran-owned, US-based supplier, producing every batch in an ISO-certified facility.
TH9507 from Oasis Labs Peptides is supplied for laboratory research use only. Oasis Labs Peptides makes every batch in the USA and verifies it with independent, U.S.-based third-party laboratories, pairing each lot with its own Certificate of Analysis.
Chemical Information of TH9507 – Tesa 10mg
- Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
- CAS Number: 218949-48-5
- Molecular Weight: 5195.9 g/mol
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular Structure: Refer to Certificate of Analysis for detailed structural information.
Storage and Handling of TH9507 – Tesa 10mg
Oasis Labs Peptides recommends the following storage and handling to maintain product integrity:
Store sealed at recommended laboratory freezer temperatures.
Protect from light, moisture, and excessive heat.
Handle using standard laboratory safety procedures to maintain product integrity.
TH9507 – Tesa 10mg Product Specifications
The specifications below reflect the standards Oasis Labs Peptides holds for every batch:
Purity: ≥99% (HPLC Verified)
Appearance: White to off-white lyophilized powder
Solubility: Refer to Certificate of Analysis for physicochemical properties
Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.
