- GLP, GIP, Glcgn & Amylin Analogs
Cagrilintide 5mg
Free Shipping on Orders Over $150!
$75.00
In stock
Chemical Information:
- Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
- Molecular Weight: 3946.32 g/mol
- Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)
- Molecular Structure: Refer to Certificate of Analysis for detailed structural information.
Storage and Handling:
-
Store sealed at recommended laboratory freezer temperatures.
-
Protect from light, moisture, and excessive heat.
-
Handle using standard laboratory safety procedures to maintain product integrity.
Product Specifications:
-
Purity: ≥99% (HPLC Verified)
-
Appearance: White to off-white lyophilized powder
-
Solubility: Refer to Certificate of Analysis for physicochemical properties
Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.





