≥99% HPLC verified

FOXO4-DRI 10mg

$217.50

In stock Purchase & earn 218 points!

Third-party tested
Sealed & lyophilized
Synthesized in USA
Same-day shipping*

*Orders before 12 PM PST, Mon–Fri. Discreet packaging on every order.

View the full FOXO4-DRI Certificate of Analysis & lab reports →

Molecular Structure

The FOXO4-DRI molecule

Know exactly what you’re getting. Explore the verified molecular structure and lab-confirmed specifications of FOXO4-DRI — third-party tested for identity and purity, and synthesized in the USA.

Drag to rotate

Molecular Formula

C₂₂₈H₃₈₈N₈₆O₆₄

Molecular Weight

5358 g/mol

CAS / ID

2460055-10-9

Physical Form

Lyophilized Powder

Documented Purity

99%+

Use Class

Research use only

Structure & molecular data from PubChem CID 167312269; the 3D conformation is an illustrative model. For research use only — not for human or veterinary use.

Description

Description

Chemical Information:

Molecular Formula: C228H388N86O64
CAS Number: 2460055-10-9
Molecular Weight: 5358.05 Da
Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-retro-inverso; all D-amino acids)
Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling:

Store sealed at recommended laboratory freezer temperatures.
Protect from light, moisture, and excessive heat.
Handle using standard laboratory safety procedures to maintain product integrity.

Product Specifications:

Purity: ≥99% (HPLC Verified)
Appearance: White to off-white lyophilized powder
Solubility: Refer to Certificate of Analysis for physicochemical properties

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

Frequently asked questions

Research use only. Not for human or veterinary use.

What is FOXO4-DRI?

FOXO4-DRI is a synthetic 46 residue peptide with the molecular formula C228H388N86O64, a molecular weight of 5358 g/mol and CAS number 2460055-10-9 (PubChem CID 167312269). Its sequence is LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG, built from D-amino acids in a retro-inverso arrangement. Oasis Labs supplies it as a lyophilized powder at 99%+ documented purity for laboratory research use only.

What does D-retro-inverso mean in FOXO4-DRI?

It describes how the molecule is built. A retro-inverso peptide reverses the order of the sequence and substitutes every residue with its D-isomer rather than the L-isomer found in most natural peptides. The result is a structurally distinct molecule that presents a similar arrangement of side chains to the original sequence. D-amino acid peptides are generally described in the literature as less susceptible to proteolysis than their L-counterparts. In FOXO4-DRI that substitution is applied across the whole 46 residue sequence, apart from the four glycines, which are achiral and have no D or L form. Supplied strictly as a research reagent. No human or veterinary use is described, supported or intended.

What has FOXO4-DRI been studied for in research settings?

Published in vitro and animal work has examined FOXO4-DRI in studies of the FOXO4-p53 protein interaction. It is a D-isomer retro-inverso peptide, meaning its sequence is reversed and its chiral residues inverted relative to the parent sequence. Oasis Labs supplies this material strictly as a research reagent. No human or veterinary use is described, supported or intended.

What are the specifications for Oasis Labs FOXO4-DRI 10mg?

SKU FOXO4-10MG. Supplied as a 10mg vial of lyophilized powder, white to off-white in appearance, at 99%+ documented purity by HPLC. Molecular formula C228H388N86O64, molecular weight 5358 g/mol, CAS 2460055-10-9, 46 amino acid residues in a D-retro-inverso arrangement. Identity, purity and net content are documented per lot on the published Certificate of Analysis.

Where can researchers buy FOXO4-DRI with a published Certificate of Analysis?

Oasis Labs supplies FOXO4-DRI direct to researchers from the USA, with fulfilment handled in Las Vegas, Nevada. Current pricing and bulk options are shown on the product page. Every lot is third-party tested and the Certificate of Analysis is published on the site and can be read in full before ordering. The FOXO4-DRI COA is available at myoasislabs.com/coa/foxo4-dri-10mg/ and the full testing methodology is documented at myoasislabs.com/coa-process/.

Is Oasis Labs FOXO4-DRI intended for human use?

No. This product is sold FOR RESEARCH USE ONLY and is not for human or veterinary use, including medical, therapeutic or diagnostic applications. It is intended exclusively for in vitro laboratory research conducted by qualified professionals. It is not a drug, food, cosmetic, dietary supplement or medical device, and nothing on this page describes or recommends administration to humans or animals.