Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

5-Amino-1MQ 10mg

Showing all 14 results

  • Sale! -15% 5-Amino-1MQ 10mg

    5-Amino-1MQ 10mg

    Original price was: $70.50.Current price is: $60.00.

    5-Amino-1MQ Chemical Information: Molecular Formula: C₇H₁₁N₅ CAS Number: 42464-96-0 Molecular Weight: 165.20 g/mol Chemical Name: 5-Amino-1-methylquinolin-1-ium Description: 5-Amino-1MQ is a small-molecule experimental compound that functions as a methyltransferase inhibitor, particularly targeting nicotinamide N-methyltransferase (NNMT). This enzyme plays a role in regulating cellular energy metabolism, making 5-Amino-1MQ a focus of research into obesity, metabolic disorders, and…

    Purchase & earn 60 points!Add to cartLoading Done
  • B12 MIC Complex 10ml

    B12 MIC Complex 10ml

    $99.50

    Chemical Information: Molecular Formula: C₆₃H₉₁CoN₁₃O₁₄P Molecular Weight: 1344.38 g/mol CAS Number: 13422-55-4 Purity: 99% Product Contains (per mL): L-Carnitine: 200 mg Arginine: 20 mg Methionine: 25 mg Inositol: 50 mg Choline: 50 mg Vitamin B5 (Dexpanthenol): 25 mg Vitamin B6 (Pyridoxine): 25 mg Vitamin B12 (Methylcobalamin): 400 mcg Storage: Store refrigerated at 2-8°C. Protect from…

    Purchase & earn 100 points!Add to cartLoading Done
  • Epithalon (Epitalon) 50mg (10ml Vial)

    Epithalon (Epitalon) 50mg (10ml Vial)

    $123.00

    Product Name:Epithalon (Epitalon / Epithalamin Analog) Chemical Information: Molecular Formula: C₁₄H₂₂N₄O₉ CAS Number: 307297-39-8 Molecular Weight: 390.35 g/mol Sequence: Ala-Glu-Asp-Gly Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Epithalon (also known as Epitalon or Epithalamin Analog) is a synthetic tetrapeptide extensively studied for its potential role in cellular aging and telomere biology….

    Purchase & earn 123 points!Add to cartLoading Done
  • FOXO4-DRI 10mg

    FOXO4-DRI 10mg

    $217.50

    Chemical Information: Molecular Formula: C228H388N86O64 CAS Number: 2460055-10-9 Molecular Weight: 5358.05 Da Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-retro-inverso; all D-amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product…

    Purchase & earn 218 points!Add to cartLoading Done
  • Sale! -14–15% GHK-Cu

    GHK-Cu

    Price range: $38.50 through $59.00

    Chemical Information: Molecular Formula: C₁₄H₂₄N₆O₄Cu CAS Number: 49557-75-7 Molecular Weight: 340.84 g/mol Sequence: Gly-His-Lys Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Earn up to 59 points.Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Sale! -15% GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    Original price was: $123.00.Current price is: $104.50.

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Purchase & earn 105 points!Add to cartLoading Done
  • Glutathione 1500mg - 10ml Vial

    Glutathione 1500mg – 10ml Vial

    $84.00

    Chemical Information: Molecular Formula: C₁₀H₁₇N₃O₆S CAS Number: 70-18-8 Molecular Weight: 307.32 g/mol Sequence: γ-L-Glutamyl-L-cysteinylglycine Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Glutathione is a naturally occurring tripeptide composed of the amino acids glutamine, cysteine, and glycine. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and…

    Purchase & earn 84 points!Add to cartLoading Done
  • Sale! -15% GHK-CU/BPC-157/TB-500/KPV 50/10/10/10mg Blend

    GHK-CU/BPC-157/TB-500/KPV 50/10/10/10mg Blend

    Original price was: $148.00.Current price is: $126.00.

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Purchase & earn 126 points!Add to cartLoading Done
  • KPV 10mg

    KPV 10mg

    $47.00

    Product Name:KPV (Lys-Pro-Val) Chemical Information: Molecular Formula: C₁₇H₂₈N₄O₅ CAS Number: 67727-97-3 Molecular Weight: 384.43 g/mol Sequence: Lys-Pro-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….

    Purchase & earn 47 points!Add to cartLoading Done
  • L-Carnitine 500mg/ml 10ml Vial

    L-Carnitine 500mg/ml 10ml Vial

    $74.50

    Chemical Information: Molecular Formula: C₇H₁₅NO₃ CAS Number: 541-15-1 Molecular Weight: 161.20 g/mol Chemical Name: (R)-3-Hydroxy-4-(trimethylammonio)butanoate Description:L-Carnitine is a water-soluble quaternary ammonium compound naturally derived from lysine and methionine. This liquid formulation provides a highly concentration of L-Carnitine at 500 mg/mL, offering ease of use and consistent measurement for research applications. L-Carnitine plays a crucial role…

    Purchase & earn 75 points!Add to cartLoading Done
  • MOTS-C

    MOTS-C

    Price range: $48.50 through $160.50

    Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ CAS Number: 1627580-64-6 Molecular Weight: 2174.63 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Earn up to 161 points.Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Sale! -15% NAD+

    NAD+

    Price range: $69.50 through $99.00

    Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ CAS Number: 53-84-9 Molecular Weight: 663.43 g/mol Sequence: N/A (NAD+ is a small molecule, not a peptide) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety…

    Earn up to 99 points.Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • SLU-PP-332 5mg

    SLU-PP-332 5mg

    $74.50

    Chemical Information: Molecular Formula: C₁₈H₁₄N₂O₂ Molecular Weight: 290.32 g/mol Chemical Name: (E)-4-Hydroxy-N’-(naphthalen-2-ylmethylene)benzohydrazide CAS Number: 303760-60-3 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:SLU-PP-332 is a novel synthetic small molecule extensively studied for its role as an estrogen-related receptor (ERR) pan-agonist, primarily targeting ERRα, ERRβ, and ERRγ. Research indicates its potential in…

    Purchase & earn 75 points!Add to cartLoading Done
  • Thymosin Alpha-1 10mg

    Thymosin Alpha-1 10mg

    $65.00

    Chemical Information: Molecular Formula: C₁₂₉H₂₁₅N₃₃O₅₅ CAS Number: 62304-98-7 Molecular Weight: 3108.28 g/mol Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Lys-Phe-Ile-Glu-Gly-Gln-Asp-Ser-Ala-Lys-Glu-Gln-Glu-Val-Val-Glu-Ala-Glu-Asn-OH Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer…

    Purchase & earn 65 points!Add to cartLoading Done