Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

CJC-1295 DAC 5mg

Showing all 10 results

  • CJC-1295 DAC 5mg

    CJC-1295 DAC 5mg

    $84.00

    Chemical Information: Molecular Formula: C₁₆₅H₂₆₉N₄₇O₄₆ CAS Number: 446262-90-4 Molecular Weight: 3647.2 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Leu-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 84 points!Add to cartLoading Done
  • CJC-1295 no DAC 5mg (Mod GRF 1-29)

    CJC-1295 no DAC 5mg (Mod GRF 1-29)

    $42.00

    Chemical Information: Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂ CAS Number: 863288-34-0 Molecular Weight: 3367.99 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Asp-Ile-Met-Ser-Arg-Lys-Lys-Gln-Gln-Phe-Gln-Gly-Leu-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:CJC-1295 no DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). In laboratory research, it has been studied for its potential to stimulate endogenous growth hormone (GH) secretion…

    Purchase & earn 42 points!Add to cartLoading Done
  • CJC/IPA Blend 5/5mg

    CJC/IPA Blend 5/5mg

    $82.00

    Chemical Information:

    CJC-1295 (No DAC):

    • Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂

    • CAS Number: 863288-34-0
    • Molecular Weight: 3367.9 g/mol

    • Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met

    Ipamorelin:

    • Molecular Formula: C₃₈H₄₉N₉O₅

    • CAS Number: 170851-70-4
    • Molecular Weight: 711.9 g/mol

    • Sequence: Aib-His-D-2-Nal-D-Phe-Lys

    • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.


    Storage and Handling:

    • Store sealed at recommended laboratory freezer temperatures.

    • Protect from light, moisture, and excessive heat.

    • Handle using standard laboratory safety procedures to maintain product integrity.

    Product Specifications:

    • Purity: ≥99% (HPLC Verified)

    • Appearance: White to off-white lyophilized powder

    • Solubility: Refer to Certificate of Analysis for physicochemical properties


    Important Note:
    This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.


    Purchase & earn 82 points!Add to cartLoading Done
  • GHRP-2 10mg

    GHRP-2 10mg

    $47.00

    Chemical Information: Molecular Formula: C45H55N9O6 CAS Number: 158861-67-7 Molecular Weight: 817.97 Da Sequence: D-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 47 points!Add to cartLoading Done
  • GHRP-6 10mg

    GHRP-6 10mg

    $47.00

    Chemical Information: Molecular Formula: C46H56N12O6 CAS Number: 87616-84-0 Molecular Weight: 873.01 Da Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 47 points!Add to cartLoading Done
  • IGF1-LR3 1mg

    IGF1-LR3 1mg

    $74.50

    Chemical Information: Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ CAS Number: 946870-92-4 Molecular Weight: 9117.53 g/mol Sequence: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIVDEC CFRSCDLRRL EMYCAPLKPAKSA Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:IGF-1 LR3 (Long Arg3 Insulin-like Growth Factor-1) is a synthetic analog of human IGF-1, specifically modified by substituting arginine at position 3 and…

    Purchase & earn 75 points!Add to cartLoading Done
  • Ipamorelin 5mg

    Ipamorelin 5mg

    $34.50

    Chemical Information: Molecular Formula: C₃₈H₄₉N₉O₅ CAS Number: 170851-70-4 Molecular Weight: 711.86 g/mol Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 35 points!Add to cartLoading Done
  • Sermorlin 5mg

    Sermorlin 5mg

    $59.50

    Chemical Information: Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S CAS Number: 86168-78-7 Molecular Weight: 3357.88 g/mol Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Sermorlin is a synthetic peptide analog of human growth hormone-releasing hormone (GHRH). Extensively studied for its potential role in stimulating endogenous secretion of growth hormone (GH), Sermorlin is frequently utilized…

    Purchase & earn 60 points!Add to cartLoading Done
  • Tesa/IPA Blend 10/1mg

    Tesa/IPA Blend 10/1mg

    $98.00

    Chemical Information: Tesa Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Tesa CAS Number: 218949-48-5 Tesa Molecular Weight: 5135.9 g/mol Ipamorelin Molecular Formula: C₃₈H₄₉N₉O₅ Ipamorelin CAS Number: 170851-70-4 Ipamorelin Molecular Weight: 711.86 g/mol Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….

    Purchase & earn 98 points!Add to cartLoading Done
  • TH9507 - Tesa 10mg

    TH9507 – Tesa 10mg

    $84.00

    Chemical Information: Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S CAS Number: 218949-48-5 Molecular Weight: 5195.9 g/mol Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 84 points!Add to cartLoading Done