Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

CJC-1295 DAC 5mg

Showing all 10 results

  • CJC-1295 DAC 5mg

    CJC-1295 DAC 5mg

    $84.00

    Chemical Information: Molecular Formula: C₁₆₅H₂₆₉N₄₇O₄₆ CAS Number: 446262-90-4 Molecular Weight: 3647.2 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Leu-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 84 points!Add to cartDone
  • CJC-1295 no DAC 5mg (Mod GRF 1-29)

    CJC-1295 no DAC 5mg (Mod GRF 1-29)

    $42.00

    Chemical Information: Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂ CAS Number: 863288-34-0 Molecular Weight: 3367.99 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Asp-Ile-Met-Ser-Arg-Lys-Lys-Gln-Gln-Phe-Gln-Gly-Leu-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:CJC-1295 no DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). In laboratory research, it has been studied for its potential to stimulate endogenous growth hormone (GH) secretion…

    Purchase & earn 42 points!Add to cartDone
  • CJC/IPA Blend 5/5mg

    CJC/IPA Blend 5/5mg

    $82.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Purchase & earn 82 points!Add to cartDone
  • GHRP-2 10mg

    GHRP-2 10mg

    $47.00

    Chemical Information: Molecular Formula: C45H55N9O6 CAS Number: 158861-67-7 Molecular Weight: 817.97 Da Sequence: D-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 47 points!Add to cartDone
  • GHRP-6 10mg

    GHRP-6 10mg

    $47.00

    Chemical Information: Molecular Formula: C46H56N12O6 CAS Number: 87616-84-0 Molecular Weight: 873.01 Da Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 47 points!Add to cartDone
  • IGF1-LR3 1mg

    IGF1-LR3 1mg

    $74.50

    Chemical Information: Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ CAS Number: 946870-92-4 Molecular Weight: 9117.53 g/mol Sequence: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIVDEC CFRSCDLRRL EMYCAPLKPAKSA Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:IGF-1 LR3 (Long Arg3 Insulin-like Growth Factor-1) is a synthetic analog of human IGF-1, specifically modified by substituting arginine at position 3 and…

    Purchase & earn 75 points!Add to cartDone
  • Ipamorelin 5mg

    Ipamorelin 5mg

    $34.50

    Chemical Information: Molecular Formula: C₃₈H₄₉N₉O₅ CAS Number: 170851-70-4 Molecular Weight: 711.86 g/mol Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 35 points!Add to cartDone
  • Sermorlin 5mg

    Sermorlin 5mg

    $59.50

    Chemical Information: Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S CAS Number: 86168-78-7 Molecular Weight: 3357.88 g/mol Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Sermorlin is a synthetic peptide analog of human growth hormone-releasing hormone (GHRH). Extensively studied for its potential role in stimulating endogenous secretion of growth hormone (GH), Sermorlin is frequently utilized…

    Purchase & earn 60 points!Add to cartDone
  • Tesa/IPA Blend 10/1mg

    Tesa/IPA Blend 10/1mg

    $98.00

    Chemical Information: Tesa Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Tesa CAS Number: 218949-48-5 Tesa Molecular Weight: 5135.9 g/mol Ipamorelin Molecular Formula: C₃₈H₄₉N₉O₅ Ipamorelin CAS Number: 170851-70-4 Ipamorelin Molecular Weight: 711.86 g/mol Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….

    Purchase & earn 98 points!Add to cartDone
  • TH9507 - Tesa 10mg

    TH9507 – Tesa 10mg

    $84.00

    Chemical Information: Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S CAS Number: 218949-48-5 Molecular Weight: 5195.9 g/mol Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 84 points!Add to cartDone