Chemical Information: Molecular Formula: C205H340N60O53 Molecular Weight: 4493.37 Da Sequence: [LL-37, 37 aa] (37 amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…