Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

5-Amino-1MQ 10mg

  • 5-Amino-1MQ 10mg

    5-Amino-1MQ 10mg

    $65.50

    5-Amino-1MQ Chemical Information: Molecular Formula: C₇H₁₁N₅ Molecular Weight: 165.20 g/mol Chemical Name: 5-Amino-1-methylquinolin-1-ium Description: 5-Amino-1MQ is a small-molecule experimental compound that functions as a methyltransferase inhibitor, particularly targeting nicotinamide N-methyltransferase (NNMT). This enzyme plays a role in regulating cellular energy metabolism, making 5-Amino-1MQ a focus of research into obesity, metabolic disorders, and age-related energy decline….

    Purchase & earn 66 points!Add to cartDone
  • 5-Amino-1MQ 50mg Capsules (60ct)

    5-Amino-1MQ 50mg Capsules (60ct)

    $230.00

    Chemical Information: Molecular Formula: C10H11N2+ (as iodide salt: C10H11N2·I) Molecular Weight: 159.21 g/mol (286.11 g/mol as iodide salt) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle…

    Purchase & earn 230 points!Add to cartDone
  • B12 MIC Complex 10ml

    B12 MIC Complex 10ml

    $92.00

    Product Contains (per mL): L-Carnitine: 200 mg Arginine: 20 mg Methionine: 25 mg Inositol: 50 mg Choline: 50 mg Vitamin B5 (Dexpanthenol): 25 mg Vitamin B6 (Pyridoxine): 25 mg Vitamin B12 (Methylcobalamin): 400 mcg Storage: Store refrigerated at 2-8°C. Protect from direct exposure to light and heat. Product Specifications: Appearance: Red solution Solubility: Fully soluble…

    Purchase & earn 92 points!Add to cartDone
  • BAM-15 50mg Capsules (60ct)

    BAM-15 50mg Capsules (60ct)

    $230.00

    Chemical Information: Molecular Formula: C16H10F2N6O Molecular Weight: 340.29 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….

    Purchase & earn 230 points!Add to cartDone
  • Epithalon (Epitalon) 50mg (10ml Vial)

    Epithalon (Epitalon) 50mg (10ml Vial)

    $114.00

    Product Name:Epithalon (Epitalon / Epithalamin Analog) Chemical Information: Molecular Formula: C₁₄H₂₂N₄O₉ Molecular Weight: 390.35 g/mol Sequence: Ala-Glu-Asp-Gly Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Epithalon (also known as Epitalon or Epithalamin Analog) is a synthetic tetrapeptide extensively studied for its potential role in cellular aging and telomere biology. Originally derived from…

    Purchase & earn 114 points!Add to cartDone
  • FOXO4-DRI 10mg

    FOXO4-DRI 10mg

    $201.50

    Chemical Information: Molecular Formula: C228H388N86O64 Molecular Weight: 5358.05 Da Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-retro-inverso; all D-amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications:…

    Purchase & earn 202 points!Add to cartDone
  • GHK-Cu

    GHK-Cu

    Price range: $41.50 through $57.00

    Chemical Information: Molecular Formula: C₁₄H₂₄N₆O₄Cu Molecular Weight: 340.84 g/mol Sequence: Gly-His-Lys Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

    Earn up to 57 points.Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • GLOW 70mg GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    GLOW 70mg GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    $114.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Purchase & earn 114 points!Add to cartDone
  • Glutathione 1500mg - 10ml Vial

    Glutathione 1500mg – 10ml Vial

    $78.00

    Chemical Information: Molecular Formula: C₁₀H₁₇N₃O₆S Molecular Weight: 307.32 g/mol Sequence: γ-L-Glutamyl-L-cysteinylglycine Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Glutathione is a naturally occurring tripeptide composed of the amino acids glutamine, cysteine, and glycine. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle…

    Purchase & earn 78 points!Add to cartDone
  • KLOW 80mg GHK-CU/BPC-157/TB-500/KPV 50/10/10/10mg Blend

    KLOW 80mg GHK-CU/BPC-157/TB-500/KPV 50/10/10/10mg Blend

    $137.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Purchase & earn 137 points!Add to cartDone
  • KPV 10mg

    KPV 10mg

    $43.50

    Product Name:KPV (Lys-Pro-Val) Chemical Information: Molecular Formula: C₁₇H₂₈N₄O₅ Molecular Weight: 384.43 g/mol Sequence: Lys-Pro-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 44 points!Add to cartDone
  • L-Carnitine 500mg/ml 10ml Vial

    L-Carnitine 500mg/ml 10ml Vial

    $69.00

    Chemical Information: Molecular Formula: C₇H₁₅NO₃ Molecular Weight: 161.20 g/mol Chemical Name: (R)-3-Hydroxy-4-(trimethylammonio)butanoate Description:L-Carnitine is a water-soluble quaternary ammonium compound naturally derived from lysine and methionine. This liquid formulation provides a highly concentration of L-Carnitine at 500 mg/mL, offering ease of use and consistent measurement for research applications. L-Carnitine plays a crucial role in mitochondrial energy…

    Purchase & earn 69 points!Add to cartDone
  • MOTS-C

    MOTS-C

    Price range: $45.00 through $148.50

    Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ Molecular Weight: 2174.63 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

    Earn up to 149 points.Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • NAD+

    NAD+

    Price range: $76.00 through $108.00

    Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ Molecular Weight: 663.43 g/mol Sequence: N/A (NAD+ is a small molecule, not a peptide) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…

    Earn up to 108 points.Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • SLU-PP-332 1000mcg Capsules (60ct)

    SLU-PP-332 1000mcg Capsules (60ct)

    $161.00

    Chemical Information: Molecular Formula: C18H14N2O2 Molecular Weight: 290.32 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….

    Purchase & earn 161 points!Add to cartDone
WAAVE Compliance