Cagrilintide 5mg

  • Sale! Cagrilintide 5mg

    Cagrilintide 5mg

    Original price was: $120.00.Current price is: $65.00.

    Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…

    Purchase & earn 65 points!Add to cartDone
  • Sale! GLP3(R) 10mg

    GLP3(R) 10mg

    Original price was: $299.00.Current price is: $99.00.

      Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

    Purchase & earn 99 points!Add to cartDone
  • Sale! GLP3(R) 15mg

    GLP3(R) 15mg

    Original price was: $350.00.Current price is: $146.00.

      Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

    Purchase & earn 146 points!Add to cartDone
  • Sale! GLP3(R) 30mg

    GLP3(R) 30mg

    Original price was: $700.00.Current price is: $289.00.

      Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

    Purchase & earn 289 points!Add to cartDone
  • Sale! GLP3(R) 5mg

    GLP3(R) 5mg

    Original price was: $200.00.Current price is: $64.00.

    Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR RESEARCH…

    Purchase & earn 64 points!Add to cartDone
  • Sale! GLP3(R) 60mg

    GLP3(R) 60mg

    Original price was: $1,280.00.Current price is: $499.00.

      Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

    Purchase & earn 499 points!Add to cartDone