Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

Cagrilintide 5mg

  • Cagrilintide 5mg

    Cagrilintide 5mg

    $75.00

    Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…

    Purchase & earn 75 points!Add to cartLoading Done
  • Sale! GLP3(R)

    GLP3(R)

    Price range: $48.00 through $368.00

      Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

    Earn up to 368 points.Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page