• Sale! Cagrilintide 5mg

    Cagrilintide 5mg

    Original price was: $120.00.Current price is: $65.00.

    Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Cagrilintide is a synthetic long-acting analog of human amylin, a peptide extensively studied for its potential roles in appetite regulation, energy balance, and metabolic control….

    Purchase & earn 65 points!Add to cartDone
  • Sale! GLP3(R) 10mg

    GLP3(R) 10mg

    Original price was: $299.00.Current price is: $99.00.

      Storage and Handling: Store lyophilized powder at -20°C. After reconstitution, refrigerate at 2-8°C and use promptly. Maintain aseptic handling practices to ensure sterility and product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: Lyophilized white powder Solubility: Soluble in bacteriostatic water Important Note:This product is strictly FOR RESEARCH USE ONLY and is intended exclusively…

    Purchase & earn 99 points!Add to cartDone
  • Sale! GLP3(R) 15mg

    GLP3(R) 15mg

    Original price was: $350.00.Current price is: $146.00.

      Storage and Handling: Store lyophilized powder at -20°C. After reconstitution, refrigerate at 2-8°C and use promptly. Maintain aseptic handling practices to ensure sterility and product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: Lyophilized white powder Solubility: Soluble in bacteriostatic water Important Note:This product is strictly FOR RESEARCH USE ONLY and is intended exclusively…

    Purchase & earn 146 points!Add to cartDone
  • Sale! GLP3(R) 30mg

    GLP3(R) 30mg

    Original price was: $700.00.Current price is: $289.00.

      Storage and Handling: Store lyophilized powder at -20°C. After reconstitution, refrigerate at 2-8°C and use promptly. Maintain aseptic handling practices to ensure sterility and product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: Lyophilized white powder Solubility: Soluble in bacteriostatic water Important Note:This product is strictly FOR RESEARCH USE ONLY and is intended exclusively…

    Purchase & earn 289 points!Add to cartDone
  • Sale! GLP3(R) 5mg

    GLP3(R) 5mg

    Original price was: $200.00.Current price is: $64.00.

        Storage and Handling: Store lyophilized powder at -20°C. After reconstitution, refrigerate at 2-8°C and use promptly. Maintain aseptic handling practices to ensure sterility and product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: Lyophilized white powder Solubility: Soluble in bacteriostatic water Important Note:This product is strictly FOR RESEARCH USE ONLY and is intended…

    Purchase & earn 64 points!Add to cartDone
  • Sale! GLP3(R) 60mg

    GLP3(R) 60mg

    Original price was: $1,280.00.Current price is: $499.00.

      Storage and Handling: Store lyophilized powder at -20°C. After reconstitution, refrigerate at 2-8°C and use promptly. Maintain aseptic handling practices to ensure sterility and product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: Lyophilized white powder Solubility: Soluble in bacteriostatic water Important Note:This product is strictly FOR RESEARCH USE ONLY and is intended exclusively…

    Purchase & earn 499 points!Add to cartDone