Showing 16–17 of 17 results
Chemical Information: Tesa Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Tesa CAS Number: 218949-48-5 Tesa Molecular Weight: 5135.9 g/mol Ipamorelin Molecular Formula: C₃₈H₄₉N₉O₅ Ipamorelin CAS Number: 170851-70-4 Ipamorelin Molecular Weight: 711.86 g/mol Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….
Chemical Information: Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S CAS Number: 218949-48-5 Molecular Weight: 5195.9 g/mol Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
