Showing 16–30 of 31 results
Chemical Information: Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ CAS Number: 946870-92-4 Molecular Weight: 9117.53 g/mol Sequence: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIVDEC CFRSCDLRRL EMYCAPLKPAKSA Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:IGF-1 LR3 (Long Arg3 Insulin-like Growth Factor-1) is a synthetic analog of human IGF-1, specifically modified by substituting arginine at position 3 and…
Chemical Information: Molecular Formula: C₃₈H₄₉N₉O₅ CAS Number: 170851-70-4 Molecular Weight: 711.86 g/mol Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
Product Name:KPV (Lys-Pro-Val) Chemical Information: Molecular Formula: C₁₇H₂₈N₄O₅ CAS Number: 67727-97-3 Molecular Weight: 384.43 g/mol Sequence: Lys-Pro-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….
Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ CAS Number: 1627580-64-6 Molecular Weight: 2174.63 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
Chemical Information: Molecular Formula: C₅₀H₆₉N₁₅O₉ CAS Number: 121062-08-6 Molecular Weight: 1024.18 g/mol Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ CAS Number: 53-84-9 Molecular Weight: 663.43 g/mol Sequence: N/A (NAD+ is a small molecule, not a peptide) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety…
All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
Product Name:Selank / Semax Blend Chemical Information: Selank Molecular Formula: C₃₃H₅₇N₁₁O₉ Selank CAS Number: 129954-34-3 Selank Molecular Weight: 751.9 g/mol Selank Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Semax Molecular Formula: C₃₇H₅₁N₉O₁₀S Semax CAS Number: 80714-61-0 Semax Molecular Weight: 813.93 g/mol Semax Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed…
Selank (Synthetic Heptapeptide Anxiolytic) Chemical Information: Molecular Formula: C₃₃H₅₇N₁₁O₉ CAS Number: 129954-34-3 Molecular Weight: 751.88 g/mol Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Selank is a synthetic heptapeptide developed as an analog of the naturally occurring tuftsin tetrapeptide. It has been widely researched for its potential anxiolytic, nootropic, and…
Semax (ACTH-Derived Neuropeptide) Chemical Information: Molecular Formula: C₃₇H₅₁N₉O₁₀S CAS Number: 80714-61-0 Molecular Weight: 813.93 g/mol Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Semax is a synthetic peptide derived from a fragment of the adrenocorticotropic hormone (ACTH). Known for its potent neuromodulatory and neuroprotective effects, Semax has garnered significant interest…
Chemical Information: Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S CAS Number: 86168-78-7 Molecular Weight: 3357.88 g/mol Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Sermorlin is a synthetic peptide analog of human growth hormone-releasing hormone (GHRH). Extensively studied for its potential role in stimulating endogenous secretion of growth hormone (GH), Sermorlin is frequently utilized…
Chemical Information: Molecular Formula: C₁₈H₁₄N₂O₂ Molecular Weight: 290.32 g/mol Chemical Name: (E)-4-Hydroxy-N’-(naphthalen-2-ylmethylene)benzohydrazide CAS Number: 303760-60-3 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:SLU-PP-332 is a novel synthetic small molecule extensively studied for its role as an estrogen-related receptor (ERR) pan-agonist, primarily targeting ERRα, ERRβ, and ERRγ. Research indicates its potential in…
Chemical Information: Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S CAS Number: 77591-33-4 Molecular Weight: 4963.49 g/mol Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asp-Lys-Glu-Ile-Ile-Glu-Gln-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
Chemical Information: Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S CAS Number: 218949-48-5 Molecular Weight: 5195.9 g/mol Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
Chemical Information: Tesa Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Tesa CAS Number: 218949-48-5 Tesa Molecular Weight: 5135.9 g/mol Ipamorelin Molecular Formula: C₃₈H₄₉N₉O₅ Ipamorelin CAS Number: 170851-70-4 Ipamorelin Molecular Weight: 711.86 g/mol Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….
