Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

KPV 10mg

  • KPV 10mg

    KPV 10mg

    $47.00

    Product Name:KPV (Lys-Pro-Val) Chemical Information: Molecular Formula: C₁₇H₂₈N₄O₅ CAS Number: 67727-97-3 Molecular Weight: 384.43 g/mol Sequence: Lys-Pro-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….

  • MOTS-C

    MOTS-C

    Price range: $48.50 through $160.50

    Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ CAS Number: 1627580-64-6 Molecular Weight: 2174.63 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • MT-2 10mg

    MT-2 10mg

    $34.50

    Chemical Information: Molecular Formula: C₅₀H₆₉N₁₅O₉ CAS Number: 121062-08-6 Molecular Weight: 1024.18 g/mol Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

  • NAD+

    NAD+

    Price range: $82.00 through $116.50

    Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ CAS Number: 53-84-9 Molecular Weight: 663.43 g/mol Sequence: N/A (NAD+ is a small molecule, not a peptide) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety…

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • PT-141 10mg

    PT-141 10mg

    $36.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

  • Selank / Semax 10/10mg Blend

    Selank / Semax 10/10mg Blend

    $96.50

    Product Name:Selank / Semax Blend Chemical Information: Selank Molecular Formula: C₃₃H₅₇N₁₁O₉ Selank CAS Number: 129954-34-3 Selank Molecular Weight: 751.9 g/mol Selank Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Semax Molecular Formula: C₃₇H₅₁N₉O₁₀S Semax CAS Number: 80714-61-0 Semax Molecular Weight: 813.93 g/mol Semax Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed…

  • Selank 10mg

    Selank 10mg

    $52.50

    Selank (Synthetic Heptapeptide Anxiolytic) Chemical Information: Molecular Formula: C₃₃H₅₇N₁₁O₉ CAS Number: 129954-34-3 Molecular Weight: 751.88 g/mol Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Selank is a synthetic heptapeptide developed as an analog of the naturally occurring tuftsin tetrapeptide. It has been widely researched for its potential anxiolytic, nootropic, and…

  • Semax 10mg

    Semax 10mg

    $48.50

    Semax (ACTH-Derived Neuropeptide) Chemical Information: Molecular Formula: C₃₇H₅₁N₉O₁₀S CAS Number: 80714-61-0 Molecular Weight: 813.93 g/mol Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Semax is a synthetic peptide derived from a fragment of the adrenocorticotropic hormone (ACTH). Known for its potent neuromodulatory and neuroprotective effects, Semax has garnered significant interest…

  • Sermorlin 5mg

    Sermorlin 5mg

    $59.50

    Chemical Information: Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S CAS Number: 86168-78-7 Molecular Weight: 3357.88 g/mol Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Sermorlin is a synthetic peptide analog of human growth hormone-releasing hormone (GHRH). Extensively studied for its potential role in stimulating endogenous secretion of growth hormone (GH), Sermorlin is frequently utilized…

  • SLU-PP-332 5mg

    SLU-PP-332 5mg

    $74.50

    Chemical Information: Molecular Formula: C₁₈H₁₄N₂O₂ Molecular Weight: 290.32 g/mol Chemical Name: (E)-4-Hydroxy-N’-(naphthalen-2-ylmethylene)benzohydrazide CAS Number: 303760-60-3 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:SLU-PP-332 is a novel synthetic small molecule extensively studied for its role as an estrogen-related receptor (ERR) pan-agonist, primarily targeting ERRα, ERRβ, and ERRγ. Research indicates its potential in…

  • TB-500 10mg

    TB-500 10mg

    $57.00

    Chemical Information: Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S CAS Number: 77591-33-4 Molecular Weight: 4963.49 g/mol Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asp-Lys-Glu-Ile-Ile-Glu-Gln-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

  • Tesa/IPA Blend 10/1mg

    Tesa/IPA Blend 10/1mg

    $98.00

    Chemical Information: Tesa Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Tesa CAS Number: 218949-48-5 Tesa Molecular Weight: 5135.9 g/mol Ipamorelin Molecular Formula: C₃₈H₄₉N₉O₅ Ipamorelin CAS Number: 170851-70-4 Ipamorelin Molecular Weight: 711.86 g/mol Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….

  • TH9507 - Tesa 10mg

    TH9507 – Tesa 10mg

    $84.00

    Chemical Information: Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S CAS Number: 218949-48-5 Molecular Weight: 5195.9 g/mol Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

  • Thymosin Alpha-1 10mg

    Thymosin Alpha-1 10mg

    $65.00

    Chemical Information: Molecular Formula: C₁₂₉H₂₁₅N₃₃O₅₅ CAS Number: 62304-98-7 Molecular Weight: 3108.28 g/mol Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Lys-Phe-Ile-Glu-Gly-Gln-Asp-Ser-Ala-Lys-Glu-Gln-Glu-Val-Val-Glu-Ala-Glu-Asn-OH Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer…

WAAVE Compliance