PT-141 10mg
$36.00All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
Showing 16–21 of 21 results
-
-
Reconstitution Water 30ml
$22.50Reconstitution BAC Water 0.9% is a solution containing 0.9% benzyl alcohol as a preservative. It is specifically prepared for laboratory research applications, intended primarily as a solvent or diluent in controlled experimental settings. The benzyl alcohol present helps inhibit bacterial growth, facilitating multiple withdrawals under aseptic conditions. Chemical Information: Molecular Formula: C₇H₈O Molecular Weight: 108.14…
-
TB-500 10mg
$57.00Chemical Information: Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S CAS Number: 77591-33-4 Molecular Weight: 4963.49 g/mol Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asp-Lys-Glu-Ile-Ile-Glu-Gln-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
-
Tesa/IPA Blend 10/1mg
$98.00Chemical Information: Tesa Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Tesa CAS Number: 218949-48-5 Tesa Molecular Weight: 5135.9 g/mol Ipamorelin Molecular Formula: C₃₈H₄₉N₉O₅ Ipamorelin CAS Number: 170851-70-4 Ipamorelin Molecular Weight: 711.86 g/mol Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity….
-
TH9507 – Tesa 10mg
$84.00Chemical Information: Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S CAS Number: 218949-48-5 Molecular Weight: 5195.9 g/mol Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
-
Thymosin Alpha-1 10mg
$65.00Chemical Information: Molecular Formula: C₁₂₉H₂₁₅N₃₃O₅₅ CAS Number: 62304-98-7 Molecular Weight: 3108.28 g/mol Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Lys-Phe-Ile-Glu-Gly-Gln-Asp-Ser-Ala-Lys-Glu-Gln-Glu-Val-Val-Glu-Ala-Glu-Asn-OH Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer…
