Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

5-Amino-1MQ 10mg

  • 5-Amino-1MQ 10mg

    5-Amino-1MQ 10mg

    $65.50

    5-Amino-1MQ Chemical Information: Molecular Formula: C₇H₁₁N₅ Molecular Weight: 165.20 g/mol Chemical Name: 5-Amino-1-methylquinolin-1-ium Description: 5-Amino-1MQ is a small-molecule experimental compound that functions as a methyltransferase inhibitor, particularly targeting nicotinamide N-methyltransferase (NNMT). This enzyme plays a role in regulating cellular energy metabolism, making 5-Amino-1MQ a focus of research into obesity, metabolic disorders, and age-related energy decline….

    Add to cartDone
  • AOD-9604 5mg

    AOD-9604 5mg

    $50.50

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Add to cartDone
  • BPC-157

    BPC-157

    Price range: $28.00 through $48.50

    Chemical Information: Molecular Formula: C₆₂H₉₈N₁₆O₂₂ Molecular Weight: 1419.54 g/mol Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of…

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • BPC-157/TB-500 Blend

    BPC-157/TB-500 Blend

    Price range: $61.00 through $102.50

    Chemical Information: BPC-157 Molecular Formula: C₆₂H₉₈N₁₆O₂₂ BPC-157 Molecular Weight: 1419.54 g/mol BPC-157 Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val TB-500 Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S TB-500 Molecular Weight: 4963.44 g/mol TB-500 Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Ala-Gln-Gly-Gln-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle…

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Cagrilintide 5mg

    Cagrilintide 5mg

    $75.00

    Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…

    Add to cartDone
  • CJC-1295 DAC 5mg

    CJC-1295 DAC 5mg

    $78.00

    Chemical Information: Molecular Formula: C₁₆₅H₂₆₉N₄₇O₄₆ Molecular Weight: 3647.2 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Leu-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

    Add to cartDone
  • CJC-1295 no DAC 5mg (Mod GRF 1-29)

    CJC-1295 no DAC 5mg (Mod GRF 1-29)

    $39.00

    Chemical Information: Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂ Molecular Weight: 3367.99 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Asp-Ile-Met-Ser-Arg-Lys-Lys-Gln-Gln-Phe-Gln-Gly-Leu-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:CJC-1295 no DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). In laboratory research, it has been studied for its potential to stimulate endogenous growth hormone (GH) secretion from the anterior…

    Add to cartDone
  • CJC/IPA Blend 5/5mg

    CJC/IPA Blend 5/5mg

    $76.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Add to cartDone
  • DSIP 5mg

    DSIP 5mg

    $34.50

    Chemical Information: Molecular Formula: C₃₅H₄₈N₁₀O₁₅ Molecular Weight: 849.8 g/mol Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

    Add to cartDone
  • Epithalon (Epitalon) 50mg (10ml Vial)

    Epithalon (Epitalon) 50mg (10ml Vial)

    $114.00

    Product Name:Epithalon (Epitalon / Epithalamin Analog) Chemical Information: Molecular Formula: C₁₄H₂₂N₄O₉ Molecular Weight: 390.35 g/mol Sequence: Ala-Glu-Asp-Gly Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Epithalon (also known as Epitalon or Epithalamin Analog) is a synthetic tetrapeptide extensively studied for its potential role in cellular aging and telomere biology. Originally derived from…

    Add to cartDone
  • GHK-Cu

    GHK-Cu

    Price range: $41.50 through $57.00

    Chemical Information: Molecular Formula: C₁₄H₂₄N₆O₄Cu Molecular Weight: 340.84 g/mol Sequence: Gly-His-Lys Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • GLOW 70mg GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    GLOW 70mg GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    $114.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Add to cartDone
  • Sale! GLP3(R)

    GLP3(R)

    Price range: $48.00 through $368.00

      Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Glutathione 1500mg - 10ml Vial

    Glutathione 1500mg – 10ml Vial

    $78.00

    Chemical Information: Molecular Formula: C₁₀H₁₇N₃O₆S Molecular Weight: 307.32 g/mol Sequence: γ-L-Glutamyl-L-cysteinylglycine Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Glutathione is a naturally occurring tripeptide composed of the amino acids glutamine, cysteine, and glycine. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle…

    Add to cartDone
  • IGF1-LR3 1mg

    IGF1-LR3 1mg

    $69.00

    Chemical Information: Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ Molecular Weight: 9117.53 g/mol Sequence: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIVDEC CFRSCDLRRL EMYCAPLKPAKSA Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:IGF-1 LR3 (Long Arg3 Insulin-like Growth Factor-1) is a synthetic analog of human IGF-1, specifically modified by substituting arginine at position 3 and adding a 13-amino…

    Add to cartDone