Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

5-Amino-1MQ 10mg

  • 5-Amino-1MQ 10mg

    5-Amino-1MQ 10mg

    $70.50

    5-Amino-1MQ Chemical Information: Molecular Formula: C₇H₁₁N₅ CAS Number: 42464-96-0 Molecular Weight: 165.20 g/mol Chemical Name: 5-Amino-1-methylquinolin-1-ium Description: 5-Amino-1MQ is a small-molecule experimental compound that functions as a methyltransferase inhibitor, particularly targeting nicotinamide N-methyltransferase (NNMT). This enzyme plays a role in regulating cellular energy metabolism, making 5-Amino-1MQ a focus of research into obesity, metabolic disorders, and…

    Add to cartDone
  • AOD-9604 5mg

    AOD-9604 5mg

    $54.50

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Add to cartDone
  • BPC-157

    BPC-157

    Price range: $30.00 through $52.50

    Chemical Information: Molecular Formula: C₆₂H₉₈N₁₆O₂₂ CAS Number: 137525-51-0 Molecular Weight: 1419.54 g/mol Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer…

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • BPC-157/TB-500 Blend

    BPC-157/TB-500 Blend

    Price range: $66.00 through $110.50

    Chemical Information: BPC-157 Molecular Formula: C₆₂H₉₈N₁₆O₂₂ BPC-157 CAS Number: 137525-51-0 BPC-157 Molecular Weight: 1419.54 g/mol BPC-157 Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val TB-500 Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S TB-500 CAS Number: 77591-33-4 TB-500 Molecular Weight: 4963.44 g/mol TB-500 Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Ala-Gln-Gly-Gln-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures….

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Cagrilintide 5mg

    Cagrilintide 5mg

    $81.00

    Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ CAS Number: 1415456-99-3 Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety…

    Add to cartDone
  • CJC-1295 DAC 5mg

    CJC-1295 DAC 5mg

    $84.00

    Chemical Information: Molecular Formula: C₁₆₅H₂₆₉N₄₇O₄₆ CAS Number: 446262-90-4 Molecular Weight: 3647.2 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Leu-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Add to cartDone
  • CJC-1295 no DAC 5mg (Mod GRF 1-29)

    CJC-1295 no DAC 5mg (Mod GRF 1-29)

    $42.00

    Chemical Information: Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂ CAS Number: 863288-34-0 Molecular Weight: 3367.99 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Asp-Ile-Met-Ser-Arg-Lys-Lys-Gln-Gln-Phe-Gln-Gly-Leu-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:CJC-1295 no DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). In laboratory research, it has been studied for its potential to stimulate endogenous growth hormone (GH) secretion…

    Add to cartDone
  • CJC/IPA Blend 5/5mg

    CJC/IPA Blend 5/5mg

    $82.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Add to cartDone
  • DSIP 5mg

    DSIP 5mg

    $37.50

    Chemical Information: Molecular Formula: C₃₅H₄₈N₁₀O₁₅ CAS Number: 62568-57-4 Molecular Weight: 849.8 g/mol Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Add to cartDone
  • Epithalon (Epitalon) 50mg (10ml Vial)

    Epithalon (Epitalon) 50mg (10ml Vial)

    $123.00

    Product Name:Epithalon (Epitalon / Epithalamin Analog) Chemical Information: Molecular Formula: C₁₄H₂₂N₄O₉ CAS Number: 307297-39-8 Molecular Weight: 390.35 g/mol Sequence: Ala-Glu-Asp-Gly Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Epithalon (also known as Epitalon or Epithalamin Analog) is a synthetic tetrapeptide extensively studied for its potential role in cellular aging and telomere biology….

    Add to cartDone
  • GHK-Cu

    GHK-Cu

    Price range: $45.00 through $61.50

    Chemical Information: Molecular Formula: C₁₄H₂₄N₆O₄Cu CAS Number: 49557-75-7 Molecular Weight: 340.84 g/mol Sequence: Gly-His-Lys Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    GHK-CU/BPC-157/TB-500 50/10/10mg Blend

    $123.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Add to cartDone
  • GHK-CU/BPC-157/TB-500/KPV 50/10/10/10mg Blend

    GHK-CU/BPC-157/TB-500/KPV 50/10/10/10mg Blend

    $148.00

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Add to cartDone
  • Sale! -25% GLP3(R)

    GLP3(R)

    Price range: $49.00 through $373.00

      Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Glutathione 1500mg - 10ml Vial

    Glutathione 1500mg – 10ml Vial

    $84.00

    Chemical Information: Molecular Formula: C₁₀H₁₇N₃O₆S CAS Number: 70-18-8 Molecular Weight: 307.32 g/mol Sequence: γ-L-Glutamyl-L-cysteinylglycine Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Glutathione is a naturally occurring tripeptide composed of the amino acids glutamine, cysteine, and glycine. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and…

    Add to cartDone
WAAVE Compliance